SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG16830_internal:A_BomoMG_comp40221_c1_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0000022 P mitotic spindle elongation
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0003677 F DNA binding
GO:0005487 F structural constituent of nuclear pore
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005643 C nuclear pore
GO:0005652 C nuclear lamina
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005719 C euchromatin
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0006325 P chromatin organization
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006606 P protein import into nucleus
GO:0006810 P transport
GO:0006913 P nucleocytoplasmic transport
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0007346 P regulation of mitotic cell cycle
GO:0009408 P response to heat
GO:0010965 P regulation of mitotic sister chromatid separation
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016363 C nuclear matrix
GO:0016568 P chromatin organization
GO:0030496 C midbody
GO:0031490 F chromatin DNA binding
GO:0031965 C nuclear membrane
GO:0032888 P regulation of mitotic spindle elongation
GO:0034399 C nuclear periphery
GO:0034401 P obsolete chromatin organization involved in regulation of transcription
GO:0034976 P response to endoplasmic reticulum stress
GO:0042405 C nuclear inclusion body
GO:0043021 F ribonucleoprotein complex binding
GO:0045840 P positive regulation of mitotic nuclear division
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051028 P mRNA transport
GO:0051225 P spindle assembly
GO:0051233 C spindle midzone
GO:0051301 P cell division
GO:0051781 P positive regulation of cell division
GO:0051983 P regulation of chromosome segregation
GO:0060236 P regulation of mitotic spindle organization
GO:0070090 C metaphase plate
GO:0072686 C mitotic spindle
GO:0090235 P regulation of metaphase plate congression
GO:0090267 P positive regulation of mitotic cell cycle spindle assembly checkpoint
GO:0090316 P positive regulation of intracellular protein transport
GO:1901673 P regulation of mitotic spindle assembly
GO:1990047 C spindle matrix
RNA-seq EntryA_BomoMG_comp40221_c1_seq1
Sequence
(Amino Acid)
EEFERHKEQFESGEMQTKIESLKNRVTELTEAQDRQTKMVNGLIRQRDMFKKLYHDHMKG
KRCETSALETLELEKSGSFTMDTSSEDISKPIEKVPFEIKYREAEKHLQLLKEEFKTYKE
EKITNERMLYEQIDNMRQEISKLTTANSKCASTSEYNNERLKILQTNVATYKKQIASLED
KNKAYNATIAKHEVSLQHLRDEALNAQSKLAAAEIQLENLKLECKLIKDAEIRLQTEKEV
LNRERQGQSLLLKNLELIKASLERVEAENRAKIETRLDEATRECSALRRRLQEEQDRFRE
LAAHLERQTEIAKTRMQEEKEAADVLRKEITEMRQDCVEKNKINEDLMKKLKFALAPNTD
GSFDTVKKIKELENKLIDKQNEIQSLKEQLNVAKEHIKQYCDISEGT
(134 a.a.)

- SilkBase 1999-2023 -