SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG16702_5prime_partial:A_BomoMG_comp40196_c0_seq3
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
Ontology
GO:0005242 F inward rectifier potassium channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005546 F phosphatidylinositol-4,5-bisphosphate binding
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0008076 C voltage-gated potassium channel complex
GO:0010107 P potassium ion import across plasma membrane
GO:0014861 P regulation of skeletal muscle contraction via regulation of action potential
GO:0015693 P magnesium ion transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0031224 C intrinsic component of membrane
GO:0034765 P regulation of ion transmembrane transport
GO:0042802 F identical protein binding
GO:0051289 P protein homotetramerization
GO:0055119 P relaxation of cardiac muscle
GO:0060306 P regulation of membrane repolarization
GO:0071805 P potassium ion transmembrane transport
GO:0086001 P cardiac muscle cell action potential
GO:0086002 P cardiac muscle cell action potential involved in contraction
GO:0086008 F voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization
GO:0086011 P membrane repolarization during action potential
GO:0086013 P membrane repolarization during cardiac muscle cell action potential
GO:0086091 P regulation of heart rate by cardiac conduction
GO:0090076 P relaxation of skeletal muscle
RNA-seq EntryA_BomoMG_comp40196_c0_seq3
Sequence
(Amino Acid)
RSCFRNTTLLFSRNAVICLRDGEFCLLFRVGDIRKSHILEAHVRAQIIRKKITREGEVLP
FYQQELKVGADGEEDRLMFIWPMTIVHKINEKSPLYNLSASDMLRERFEIVVMLEGVIES
TGMTTQARSSFLPSEILWGHRFETMVKFRKDTGEYEVDYTRFNNTYEVDTPLCSAKQLDE
LRASVSTSQKLDRMLPKTFSNDTLELSSIDSMSLDEHIEIKIPESRARENRLMAQTNFVQ
HVNEKNKNPSHHNHLAVENGQDLLHKNTIESRVEGKDNHHMHRSHSHASMKRVHGLIPNG
ICHPISGHEHVPDDHTLNKSPSENFIGKTPVIPILVTSPEAEPA
*(114 a.a.)

- SilkBase 1999-2023 -