SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG16001_5prime_partial:A_BomoMG_comp40063_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0001843 P neural tube closure
GO:0002093 P auditory receptor cell morphogenesis
GO:0002474 P antigen processing and presentation of peptide antigen via MHC class I
GO:0003151 P outflow tract morphogenesis
GO:0005215 F transporter activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0008270 F zinc ion binding
GO:0012507 C ER to Golgi transport vesicle membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0021747 P cochlear nucleus development
GO:0030127 C COPII vesicle coat
GO:0030134 C COPII-coated ER to Golgi transport vesicle
GO:0035909 P aorta morphogenesis
GO:0048208 P COPII vesicle coating
GO:0048471 C perinuclear region of cytoplasm
GO:0060088 P auditory receptor cell stereocilium organization
GO:0060425 P lung morphogenesis
GO:0060463 P lung lobe morphogenesis
GO:0060982 P coronary artery morphogenesis
GO:0061156 P pulmonary artery morphogenesis
GO:0072358 P circulatory system development
GO:0090178 P regulation of establishment of planar polarity involved in neural tube closure
GO:1901301 P regulation of cargo loading into COPII-coated vesicle
RNA-seq EntryA_BomoMG_comp40063_c0_seq1
Sequence
(Amino Acid)
APGLPAPAALRLLPLYLLALLKRKAFRTGTSTRLDDRVADMCSLKCLPLEQLLRLVYPAL
YPLHALAPPAPPHDAPCPPRLHLSAERINSNGAYLLDDGECMIIYVCHGVAPAFLADAFG
VSAHAQLGDEGRALPRLDTEPSALLHAFIDKLNDDRPYASEILILKDNSPSRHLFLERLV
DDRVESAFSYYEFLQHIKSLVK
*(66 a.a.)

- SilkBase 1999-2023 -