| Name | O_BomoMG159_internal:A_BomoMG_comp17359_c0_seq1 |
| Scaffold_id | Bomo_Chr24 |
NCBI non-redundant (nr) | PREDICTED:_gastrula_zinc_finger_protein_XlCGF46.1-like_[Bombyx_mori] |
| Ontology |
| GO:0000122 |
P |
negative regulation of transcription by RNA polymerase II |
| GO:0001666 |
P |
response to hypoxia |
| GO:0001822 |
P |
kidney development |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003677 |
F |
DNA binding |
| GO:0003700 |
F |
DNA-binding transcription factor activity |
| GO:0005622 |
C |
intracellular anatomical structure |
| GO:0005634 |
C |
nucleus |
| GO:0005730 |
C |
nucleolus |
| GO:0006351 |
P |
transcription, DNA-templated |
| GO:0006355 |
P |
regulation of transcription, DNA-templated |
| GO:0007275 |
P |
multicellular organism development |
| GO:0007576 |
P |
nucleolar fragmentation |
| GO:0046872 |
F |
metal ion binding |
| GO:0051593 |
P |
response to folic acid |
|
| RNA-seq Entry | A_BomoMG_comp17359_c0_seq1 |
Sequence (Amino Acid) | GVSYVNRTSLRVHVQGQHREKKCPQCPMVFPGNSAKSAHLHKVHAKKPYLRRCLHCDKTF
PYAYQLNEHCVSEHGRKRESHCCQECGKLFLTRQNLRIHTKSVHVRERKHG
(36 a.a.) |