SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG15598_internal:A_BomoMG_comp40007_c0_seq1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)
Ontology
GO:0001891 C phagocytic cup
GO:0005886 C plasma membrane
GO:0006909 P phagocytosis
GO:0007155 P cell adhesion
GO:0007517 P muscle organ development
GO:0014719 P skeletal muscle satellite cell activation
GO:0014816 P skeletal muscle satellite cell differentiation
GO:0014841 P skeletal muscle satellite cell proliferation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0034109 P homotypic cell-cell adhesion
GO:0042995 C cell projection
GO:0043654 P recognition of apoptotic cell
GO:0048641 P regulation of skeletal muscle tissue development
GO:0051147 P regulation of muscle cell differentiation
GO:0055001 P muscle cell development
RNA-seq EntryA_BomoMG_comp40007_c0_seq1
Sequence
(Amino Acid)
CRCANNSSCAADSGRCVCAAGWTGERCDRPCPERTYGAGCTQRCPHSLPENTTCDPVTGK
YSCASGYTGVACEYPCPLGTYGLDCQNKCVCKNDADCHHVTGVCQCRPGW
(35 a.a.)

- SilkBase 1999-2023 -