SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG15519_internal:A_BomoMG_comp39988_c1_seq1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
Ontology
GO:0001047 F core promoter sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007417 P central nervous system development
GO:0007623 P circadian rhythm
GO:0032922 P circadian regulation of gene expression
GO:0045739 P positive regulation of DNA repair
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046983 F protein dimerization activity
GO:0048511 P rhythmic process
GO:0051775 P response to redox state
GO:0051879 F Hsp90 protein binding
GO:0060548 P negative regulation of cell death
GO:2001020 P regulation of response to DNA damage stimulus
RNA-seq EntryA_BomoMG_comp39988_c1_seq1
Sequence
(Amino Acid)
YNPYLYQGYPPYQQQGVAVPQNAPPPQAQPYNMRQNSPALALLLNTQRNQMPLDPIICPQ
PSGSDEQPPKVESPRELRNKAEKQRRDKLNQSIAELASMVPPVVASNKKIDKTGVLRLTA
HYLRAHQYVFCNKMVHTNPDFNPEFTDAVLKLFNGFLITTTYRGIIVVVSK
(56 a.a.)

- SilkBase 1999-2023 -