SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG15261_3prime_partial:A_BomoMG_comp39933_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0001094 F TFIID-class transcription factor complex binding
GO:0001128 F obsolete RNA polymerase II transcription coactivator activity involved in preinitiation complex assembly
GO:0001129 F obsolete RNA polymerase II transcription factor activity, TBP-class protein binding, involved in preinitiation complex assembly
GO:0005634 C nucleus
GO:0005672 C transcription factor TFIIA complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0017025 F TBP-class protein binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051123 P RNA polymerase II preinitiation complex assembly
RNA-seq EntryA_BomoMG_comp39933_c0_seq1
Sequence
(Amino Acid)
MTTSQLAVLKLYNIVVDDVISGVRNSFLDDGVDEQVLQELKQLWKTKLQASGATDPLQPE
PMLPPPPVLQNFQKVNGSNVVHKRTDMGHTSGQQEHSAPASSVAGTHTHHILDPNN
(37 a.a.)

- SilkBase 1999-2023 -