SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG15199_3prime_partial:A_BomoMG_comp39905_c0_seq4
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0005515 F protein binding
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005776 C autophagosome
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006904 P vesicle docking involved in exocytosis
GO:0006914 P autophagy
GO:0007032 P endosome organization
GO:0007040 P lysosome organization
GO:0008270 F zinc ion binding
GO:0008333 P endosome to lysosome transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0016192 P vesicle-mediated transport
GO:0019904 F protein domain specific binding
GO:0019905 F syntaxin binding
GO:0030136 C clathrin-coated vesicle
GO:0030139 C endocytic vesicle
GO:0030674 F protein-macromolecule adaptor activity
GO:0030897 C HOPS complex
GO:0031410 C cytoplasmic vesicle
GO:0031647 P regulation of protein stability
GO:0031902 C late endosome membrane
GO:0034058 P endosomal vesicle fusion
GO:0035542 P regulation of SNARE complex assembly
GO:0046872 F metal ion binding
GO:1902115 P regulation of organelle assembly
GO:1903364 P positive regulation of cellular protein catabolic process
GO:1903955 P positive regulation of protein targeting to mitochondrion
GO:2000643 P positive regulation of early endosome to late endosome transport
RNA-seq EntryA_BomoMG_comp39905_c0_seq4
Sequence
(Amino Acid)
MAFLEWRRFTFFDVQNGADNGKIAECLQDTNVTVATSGNGQVVLCDDTGWAHLISRLWAI
TSFKAYEITITQAQQLPHDPYLVTIGDDEPGVNPLIKVWDLSRTDRHGNPICVRVSRAVP
SHMRPMHVTALAVHENKNLLAVGFQDGSVALYRGDIARQRSGKMRTLAETGSSPITGLAF
KGAEKLFVVSRVSVMLVWLSTDRCESLDPMGAAPGCSVLADKHRLTVATNKAIYCYTTEG
RGPCYALEGDKVALNCFRSYLVITANEPAAKPGATTSTAPAAR
(93 a.a.)

- SilkBase 1999-2023 -