SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG14986_5prime_partial:A_BomoMG_comp39862_c0_seq5
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0007015 P actin filament organization
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007568 P aging
GO:0008022 F protein C-terminus binding
GO:0008157 F protein phosphatase 1 binding
GO:0010976 P positive regulation of neuron projection development
GO:0014069 C postsynaptic density
GO:0015629 C actin cytoskeleton
GO:0019722 P calcium-mediated signaling
GO:0019901 F protein kinase binding
GO:0019904 F protein domain specific binding
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030175 C filopodium
GO:0030425 C dendrite
GO:0030426 C growth cone
GO:0030833 P regulation of actin filament polymerization
GO:0030864 C cortical actin cytoskeleton
GO:0031175 P neuron projection development
GO:0031594 C neuromuscular junction
GO:0032403 F protein-containing complex binding
GO:0042803 F protein homodimerization activity
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043197 C dendritic spine
GO:0044325 F transmembrane transporter binding
GO:0044326 C dendritic spine neck
GO:0045202 C synapse
GO:0045860 P positive regulation of protein kinase activity
GO:0048666 P neuron development
GO:0051015 F actin filament binding
GO:0051020 F GTPase binding
GO:0051489 P regulation of filopodium assembly
GO:0051497 P negative regulation of stress fiber assembly
GO:0051823 P regulation of synapse structural plasticity
GO:0051963 P regulation of synapse assembly
GO:0060079 P excitatory postsynaptic potential
GO:0060999 P positive regulation of dendritic spine development
GO:0061001 P regulation of dendritic spine morphogenesis
GO:0097237 P cellular response to toxic substance
GO:1900272 P negative regulation of long-term synaptic potentiation
GO:1900454 P positive regulation of long-term synaptic depression
GO:1904049 P negative regulation of spontaneous neurotransmitter secretion
GO:1990761 C growth cone lamellipodium
RNA-seq EntryA_BomoMG_comp39862_c0_seq5
Sequence
(Amino Acid)
RTRALVRAREEWWSAALREAHREYAAALSALHDRVARLEVLLLETQKKAGLPVMLPHEPS
ARRETPPLPRRPDPDPLLINNPWSSDSDLSDLSPVEDEYAKVDKSDRRREPPDLGDVTAT
SCDELPANTATAEPVVVSSPPMPVASSPPAVTSSSAVTSSSVTTSSPGNAVTVIPPLPVT
VTSSSVPTPIPTATVAATGGSTDSMALDAAVPRGALLDTSWHRARTDLARHRHHAHSPHS
QHSLSNASSYDGLDDSYNDSADESLSESTSGAPTHTGATRETRQSCGSSIGSATDDGVYS
REHRHHALSGPAASLAEQLKQVLAERERRLAVSSPPDPVRLTNELVDEIRQAVSEANARV
KKAPACVVGGEVPWQPLSSAVSESSLVPPPQQHAVNLWTKQQVWHWVSGLGEGLERHAGA
FAARGVDGALLLALSSADLKLLGLPGDERRRMKRRLKELRAAHEKHLKALKKAEKKAKKK
*(159 a.a.)

- SilkBase 1999-2023 -