SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG14904_complete:A_BomoMG_comp39849_c0_seq3
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)
Ontology
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001012 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006974 P cellular response to DNA damage stimulus
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007422 P peripheral nervous system development
GO:0007423 P sensory organ development
GO:0007530 P sex determination
GO:0007541 P sex determination, primary response to X:A ratio
GO:0008134 F transcription factor binding
GO:0008407 P chaeta morphogenesis
GO:0016330 P second mitotic wave involved in compound eye morphogenesis
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0030707 P ovarian follicle cell development
GO:0035019 P somatic stem cell population maintenance
GO:0042803 F protein homodimerization activity
GO:0043565 F sequence-specific DNA binding
GO:0045464 P R8 cell fate specification
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0048477 P oogenesis
GO:0048663 P neuron fate commitment
GO:0061101 P neuroendocrine cell differentiation
GO:0061382 P Malpighian tubule tip cell differentiation
RNA-seq EntryA_BomoMG_comp39849_c0_seq3
Sequence
(Amino Acid)
MAGPGTIPMTVGVGGHLSSGRPSSSLPSCSSADEDDVDPDTKAARERERRQANNVRERIR
IRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRR
EEEKAEEAPKLLAAPLQHYQPMPGMGQLPGQPPTGPPQQ
*(52 a.a.)

- SilkBase 1999-2023 -