| Name | O_BomoMG14854_3prime_partial:A_BomoMG_comp39833_c0_seq2 |
| Scaffold_id | Bomo_Chr16 |
NCBI non-redundant (nr) | |
| Ontology |
| GO:0000139 |
C |
Golgi membrane |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003677 |
F |
DNA binding |
| GO:0005515 |
F |
protein binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0005793 |
C |
endoplasmic reticulum-Golgi intermediate compartment |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005802 |
C |
trans-Golgi network |
| GO:0005856 |
C |
cytoskeleton |
| GO:0006259 |
P |
DNA metabolic process |
| GO:0007030 |
P |
Golgi organization |
| GO:0016020 |
C |
membrane |
| GO:0016459 |
C |
myosin complex |
| GO:0016477 |
P |
cell migration |
| GO:0016887 |
F |
ATP hydrolysis activity |
| GO:0031032 |
P |
actomyosin structure organization |
| GO:0042641 |
C |
actomyosin |
| GO:0043066 |
P |
negative regulation of apoptotic process |
| GO:0043531 |
F |
ADP binding |
| GO:0044822 |
F |
RNA binding |
| GO:0048194 |
P |
Golgi vesicle budding |
| GO:0050714 |
P |
positive regulation of protein secretion |
| GO:0051015 |
F |
actin filament binding |
| GO:0090161 |
P |
Golgi ribbon formation |
| GO:0090164 |
P |
asymmetric Golgi ribbon formation |
|
| RNA-seq Entry | A_BomoMG_comp39833_c0_seq2 |
Sequence (Amino Acid) | MSDDTEVQDAYEEVEEQRAVAAQWKRKLQKLTNDMADLRSLLDEQTCRNNLLEKRQRKFD
GELQAAQEELKRERSAKERISRERDLAQAEKFAMEQSLSEARMELELKEERLSAAARELE
ERGGGGDEL
(42 a.a.) |