SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG14342_5prime_partial:A_BomoMG_comp39695_c0_seq2
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006915 P apoptotic process
GO:0007253 P cytoplasmic sequestering of NF-kappaB
GO:0008219 P cell death
GO:0010942 P positive regulation of cell death
GO:0019887 F protein kinase regulator activity
GO:0019901 F protein kinase binding
GO:0019904 F protein domain specific binding
GO:0030155 P regulation of cell adhesion
GO:0031072 F heat shock protein binding
GO:0031265 C CD95 death-inducing signaling complex
GO:0031334 P positive regulation of protein-containing complex assembly
GO:0031625 F ubiquitin protein ligase binding
GO:0034098 C VCP-NPL4-UFD1 AAA ATPase complex
GO:0042176 P regulation of protein catabolic process
GO:0043065 P positive regulation of apoptotic process
GO:0043130 F ubiquitin binding
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045859 P regulation of protein kinase activity
GO:0048471 C perinuclear region of cytoplasm
GO:0051059 F NF-kappaB binding
GO:1902043 P positive regulation of extrinsic apoptotic signaling pathway via death domain receptors
RNA-seq EntryA_BomoMG_comp39695_c0_seq2
Sequence
(Amino Acid)
DDVAERLTTTYTLHIKHNDRDYTLKYPGTKSVREVKNDIYSLTDIPARHQSWTGWPSVSG
LDDTVLAMVGLDLPQHELTVKRAPAKPLKEYKRIIVESSDSENSSVEEVEDTGFTGEDDM
FVDIANSKKWKTPASREKTTCSST
*(47 a.a.)

- SilkBase 1999-2023 -