SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG14179_5prime_partial:A_BomoMG_comp39663_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
Ontology
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0002376 P immune system process
GO:0003712 F transcription coregulator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0005719 C euchromatin
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007517 P muscle organ development
GO:0007526 P larval somatic muscle development
GO:0016203 P muscle attachment
GO:0035060 C brahma complex
GO:0045087 P innate immune response
GO:0045088 P regulation of innate immune response
GO:0045089 P positive regulation of innate immune response
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050829 P defense response to Gram-negative bacterium
RNA-seq EntryA_BomoMG_comp39663_c0_seq1
Sequence
(Amino Acid)
ASCSSSSGSEGDCSPPHQSAHGPQRARTRALFTFKQVRMICERMLHDQEVALRAEYESVL
STKLAEQYEAFVRFNLDQVQRRPPPSTCMSLGMDAEHMHQDLVPSYLS
*(35 a.a.)

- SilkBase 1999-2023 -