SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG13984_3prime_partial:A_BomoMG_comp39605_c0_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
Ontology
GO:0005765 C lysosomal membrane
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0006622 P protein targeting to lysosome
GO:0006810 P transport
GO:0006829 P zinc ion transport
GO:0006886 P intracellular protein transport
GO:0007596 P blood coagulation
GO:0008089 P anterograde axonal transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0019882 P antigen processing and presentation
GO:0019903 F protein phosphatase binding
GO:0030117 C membrane coat
GO:0030123 C AP-3 adaptor complex
GO:0030131 C clathrin adaptor complex
GO:0030665 C clathrin-coated vesicle membrane
GO:0030742 F GTP-dependent protein binding
GO:0031410 C cytoplasmic vesicle
GO:0032438 P melanosome organization
GO:0048007 P antigen processing and presentation, exogenous lipid antigen via MHC class Ib
GO:0048490 P anterograde synaptic vesicle transport
GO:0051138 P positive regulation of NK T cell differentiation
GO:1904115 C axon cytoplasm
RNA-seq EntryA_BomoMG_comp39605_c0_seq1
Sequence
(Amino Acid)
MSPDSITPVGPSLVPPISTELVSRVLSGGLSASRRWTRAPHLYSNNMCTLEISFTNCAGV
EVQNIHISKKFLSGSRSVHEFSPIPSLGPGASATVTLGIDFADSIQPVELAVSSSLGEVT
VTIKPPVGELMRAVSMSESRWDAEFDKLRGLTECEREGAPLEDDALVCRRVFETANLAAV
GAPGDPLRFAGRLLSSQELVLVAAAVVPGAGAG
(70 a.a.)

- SilkBase 1999-2023 -