SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG1392_complete:A_BomoMG_comp20230_c0_seq2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		PREDICTED:_eukaryotic_translation_initiation_factor_4A_isoform_X1_[Bombyx_mori]
Ontology
GO:0000022 P mitotic spindle elongation
GO:0000166 F nucleotide binding
GO:0000339 F RNA cap binding
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0002168 P instar larval development
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003724 F RNA helicase activity
GO:0003729 F mRNA binding
GO:0003743 F translation initiation factor activity
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005875 C microtubule associated complex
GO:0006268 P DNA unwinding involved in DNA replication
GO:0006412 P translation
GO:0006413 P translational initiation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007279 P pole cell formation
GO:0007446 P imaginal disc growth
GO:0009950 P dorsal/ventral axis specification
GO:0010501 P RNA secondary structure unwinding
GO:0016281 C eukaryotic translation initiation factor 4F complex
GO:0016787 F hydrolase activity
GO:0017116 F single-stranded DNA helicase activity
GO:0030718 P germ-line stem cell population maintenance
GO:0043186 C P granule
GO:0048132 P female germ-line stem cell asymmetric division
GO:0048477 P oogenesis
GO:0051297 P centrosome cycle
GO:0072686 C mitotic spindle
RNA-seq EntryA_BomoMG_comp20230_c0_seq2
Sequence
(Amino Acid)
MSYSSERRSEDWPEDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEELLR
GIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALI
LAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI
TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKMLSADVQVILLSATMPDDVLEVSRC
FMRDPVRILVQKEELTLEGIKQFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVD
WLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITTDLLARGIDVQQVSCVIN
YDLPSNRENYIHRIGRGGRFGRKGIAINFVTEADRRALKDIEDFYHTSIVEMPSDVANLI
*(139 a.a.)

- SilkBase 1999-2023 -