| Name | O_BomoMG13852_3prime_partial:A_BomoMG_comp39564_c1_seq1 |
| Scaffold_id | Bomo_Chr16 |
NCBI non-redundant
(nr) | |
| Ontology |
| GO:0000138 |
C |
Golgi trans cisterna |
| GO:0000139 |
C |
Golgi membrane |
| GO:0000149 |
F |
SNARE binding |
| GO:0005484 |
F |
SNAP receptor activity |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005797 |
C |
Golgi medial cisterna |
| GO:0005801 |
C |
cis-Golgi network |
| GO:0006810 |
P |
transport |
| GO:0006888 |
P |
endoplasmic reticulum to Golgi vesicle-mediated transport |
| GO:0006891 |
P |
intra-Golgi vesicle-mediated transport |
| GO:0006906 |
P |
vesicle fusion |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016192 |
P |
vesicle-mediated transport |
| GO:0031201 |
C |
SNARE complex |
| GO:0048193 |
P |
Golgi vesicle transport |
| GO:0048209 |
P |
regulation of vesicle targeting, to, from or within Golgi |
|
| RNA-seq Entry | A_BomoMG_comp39564_c1_seq1 |
Sequence
(Amino Acid) | MSTITAPWEELRRQARTLENDIDVKLVAFSKLGISSGSANINSETAPLINSDDMFDTMSM
ELQQLLNQLSSINDKMADIAPSGAATMHTIKRHREILMDYQQEYSRTSARVSARREREEL
LRGGSPTPPAAGLSRRDQYAKEANH
(47 a.a.) |
