SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG13808_internal:A_BomoMG_comp39553_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0006468 P protein phosphorylation
GO:0007155 P cell adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0008305 C integrin complex
GO:0009792 P embryo development ending in birth or egg hatching
GO:0009925 C basal plasma membrane
GO:0016020 C membrane
GO:0030239 P myofibril assembly
GO:0031430 C M band
GO:0032956 P regulation of actin cytoskeleton organization
GO:0045987 P positive regulation of smooth muscle contraction
GO:0048815 P hermaphrodite genitalia morphogenesis
GO:0055120 C striated muscle dense body
GO:0060279 P positive regulation of ovulation
GO:1903356 P positive regulation of distal tip cell migration
GO:1904901 P positive regulation of myosin II filament organization
RNA-seq EntryA_BomoMG_comp39553_c0_seq1
Sequence
(Amino Acid)
DAAAALRLAHDVARGMRYLHSLQRDTILPAYHLNSKHIMIDEDLTARINMADAKFSFQER
GRVYAPAWMAPEALLKPAAKRNWEAADMWSFAVLLWELATREI
(33 a.a.)

- SilkBase 1999-2023 -