SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG136_internal:A_BomoMG_comp17303_c0_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		PREDICTED:_voltage-dependent_L-type_calcium_channel_subunit_beta-2_isoform_X5_[Plutella_xylostella]
Ontology
GO:0005244 F voltage-gated ion channel activity
GO:0005245 F voltage-gated calcium channel activity
GO:0005246 F calcium channel regulator activity
GO:0005262 F calcium channel activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005891 C voltage-gated calcium channel complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0007268 P chemical synaptic transmission
GO:0007528 P neuromuscular junction development
GO:0007601 P visual perception
GO:0008331 F high voltage-gated calcium channel activity
GO:0016020 C membrane
GO:0019901 F protein kinase binding
GO:0019904 F protein domain specific binding
GO:0034765 P regulation of ion transmembrane transport
GO:0042383 C sarcolemma
GO:0051015 F actin filament binding
GO:0051219 F phosphoprotein binding
GO:0051928 P positive regulation of calcium ion transport
GO:0061337 P cardiac conduction
GO:0070509 P calcium ion import
GO:0070588 P calcium ion transmembrane transport
GO:0086007 F voltage-gated calcium channel activity involved in cardiac muscle cell action potential
GO:0086045 P membrane depolarization during AV node cell action potential
GO:0086056 F voltage-gated calcium channel activity involved in AV node cell action potential
GO:0086091 P regulation of heart rate by cardiac conduction
GO:0090002 P protein localization to plasma membrane
GO:0098912 P membrane depolarization during atrial cardiac muscle cell action potential
GO:1901385 P regulation of voltage-gated calcium channel activity
GO:1901843 P positive regulation of high voltage-gated calcium channel activity
GO:1904879 P positive regulation of calcium ion transmembrane transport via high voltage-gated calcium channel
GO:1990454 C L-type voltage-gated calcium channel complex
RNA-seq EntryA_BomoMG_comp17303_c0_seq1
Sequence
(Amino Acid)
KDVFLNMDHFIRQRYKRAGRRGSAESNCSQPSSELSLDDDKEALRREKEAQALSQLDKAR
SKPVAFAVRTNVAYDAKIDDDSPVHGTAISFDVRDFLHIKEKYDNNWWIGRLVAENSDIG
FIPSPVKLEMVRAGLAARGRSALAAHPHSRGSTPPTPGDESDSAGRGRGAGALPAGKEKK
KPFFKKQEA
(62 a.a.)

- SilkBase 1999-2023 -