SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG13569_internal:A_BomoMG_comp39491_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
Ontology
GO:0001518 C voltage-gated sodium channel complex
GO:0005244 F voltage-gated ion channel activity
GO:0005272 F sodium channel activity
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006814 P sodium ion transport
GO:0007399 P nervous system development
GO:0010460 P positive regulation of heart rate
GO:0010765 P positive regulation of sodium ion transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017080 F sodium channel regulator activity
GO:0019233 P sensory perception of pain
GO:0030018 C Z disc
GO:0034765 P regulation of ion transmembrane transport
GO:0035725 P sodium ion transmembrane transport
GO:0044325 F transmembrane transporter binding
GO:0051899 P membrane depolarization
GO:0060048 P cardiac muscle contraction
GO:0060371 P regulation of atrial cardiac muscle cell membrane depolarization
GO:0060373 P regulation of ventricular cardiac muscle cell membrane depolarization
GO:0061337 P cardiac conduction
GO:0072659 P protein localization to plasma membrane
GO:0086002 P cardiac muscle cell action potential involved in contraction
GO:0086005 P ventricular cardiac muscle cell action potential
GO:0086006 F voltage-gated sodium channel activity involved in cardiac muscle cell action potential
GO:0086010 P membrane depolarization during action potential
GO:0086012 P membrane depolarization during cardiac muscle cell action potential
GO:0086014 P atrial cardiac muscle cell action potential
GO:0086015 P SA node cell action potential
GO:0086091 P regulation of heart rate by cardiac conduction
GO:2000649 P regulation of sodium ion transmembrane transporter activity
RNA-seq EntryA_BomoMG_comp39491_c0_seq1
Sequence
(Amino Acid)
APRSRILVTPKYAPGVDMFRVCCLILFLVADTRQLSITKFSVPQSVEVGHNAELRCEYDL
KPEELKKVIFVKWWWRPFGEDKQQIYQRTVGQPAKSTQHTIDMQIKENDTLVLLNIHPNA
SGIYECEVSNIEEVRKEQELIVYAKGTGPRLDITDVAVGPGEESV
(54 a.a.)

- SilkBase 1999-2023 -