SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG13364_5prime_partial:A_BomoMG_comp39438_c0_seq2
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000228 C nuclear chromosome
GO:0000781 C chromosome, telomeric region
GO:0001147 F transcription termination site sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0006353 P DNA-templated transcription, termination
GO:0006369 P termination of RNA polymerase II transcription
GO:0006376 P mRNA splice site selection
GO:0006396 P RNA processing
GO:0006974 P cellular response to DNA damage stimulus
GO:0007283 P spermatogenesis
GO:0007399 P nervous system development
GO:0007623 P circadian rhythm
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0010976 P positive regulation of neuron projection development
GO:0016787 F hydrolase activity
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0030426 C growth cone
GO:0032508 P DNA duplex unwinding
GO:0033120 P positive regulation of RNA splicing
GO:0034599 P cellular response to oxidative stress
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0043066 P negative regulation of apoptotic process
GO:0043491 P protein kinase B signaling
GO:0044344 P cellular response to fibroblast growth factor stimulus
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048511 P rhythmic process
GO:0060566 P positive regulation of DNA-templated transcription, termination
GO:0070301 P cellular response to hydrogen peroxide
GO:0071300 P cellular response to retinoic acid
GO:2000144 P positive regulation of DNA-templated transcription, initiation
GO:2000806 P positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled
RNA-seq EntryA_BomoMG_comp39438_c0_seq2
Sequence
(Amino Acid)
FYQSIYPARIYRKMNIFKQGDNIIVKPLTSITKELLLFEAMDYLASSPLCSTILNPEPSH
FAKVESTVDMNLQWMKTLNHSQQTAVCASVSSAMSERPSLQMIQGPPGTGKSSVICAIVK
TYFYDGNNKKHQNRGKILICATSNAAVDELVIRLLNIRQKLPKEERFGMVRVGRVEAMHP
RAQLVSSHQLALREEARHDAHAHHPAVAQEIAILEAKLNMWKVAIENAKDAGRIAYCQGR
INEFSKKIQSLQSKGRAGGGLAAVERRIVEGADVIVTTLGSALNYKMRGLKHRIALCIID
EAGQAIEPETLIPLALDVKHVTLIGDPQQLPGYICSQRAKEHRLGESLFSRLTSCAEHWA
ESPVVLLNQQYRMHPDIVDYPNRSFYNSLIRTVYAPRPPIDVPPYCIVSVSSGDTTQSSV
GVNETEAWGVARLAGALAGVTRDRGLSLAIITPYNAQKDLIKENLRKLHARGTAGVEVNT
VDSFQGQERDVVVVSVARTHGVGFLSHAGRTNVMLTRARHALLVCLDPHATLKNPQWRTL
IEDAQQRNMYRVLPSFLCHPGNVMQIPDEQILKCLQTPR
*(192 a.a.)

- SilkBase 1999-2023 -