SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG12697_complete:A_BomoMG_comp39240_c1_seq8
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)
Ontology
GO:0005096 F GTPase activator activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005802 C trans-Golgi network
GO:0005881 C cytoplasmic microtubule
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006355 P regulation of transcription, DNA-templated
GO:0008013 F beta-catenin binding
GO:0008219 P cell death
GO:0009950 P dorsal/ventral axis specification
GO:0009968 P negative regulation of signal transduction
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0019901 F protein kinase binding
GO:0030154 P cell differentiation
GO:0030877 C beta-catenin destruction complex
GO:0035412 P regulation of canonical Wnt signaling pathway
GO:0043547 P positive regulation of GTPase activity
GO:0070016 F armadillo repeat domain binding
GO:0071407 P cellular response to organic cyclic compound
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0090244 P Wnt signaling pathway involved in somitogenesis
RNA-seq EntryA_BomoMG_comp39240_c1_seq8
Sequence
(Amino Acid)
MRSTAGRKVFRDFLRGEYSEENIMFWLACEELKRETDPDAVEEKARFIYEDYISILSPKE
VSLDSRVREIVNRNMVEPTPHTFDEAQLQIYTLMHRDSYPRFVNSPLYKTLARLPEP
*(38 a.a.)

- SilkBase 1999-2023 -