| Name | O_BomoMG12621_complete:A_BomoMG_comp39213_c0_seq2 |
| Scaffold_id | Bomo_Chr26 |
NCBI non-redundant (nr) | |
| Ontology |
| GO:0004497 |
F |
monooxygenase activity |
| GO:0005506 |
F |
iron ion binding |
| GO:0005575 |
C |
cellular_component |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0005789 |
C |
endoplasmic reticulum membrane |
| GO:0006629 |
P |
lipid metabolic process |
| GO:0010430 |
P |
fatty acid omega-oxidation |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016491 |
F |
oxidoreductase activity |
| GO:0016705 |
F |
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
| GO:0020037 |
F |
heme binding |
| GO:0046872 |
F |
metal ion binding |
| GO:0055114 |
P |
obsolete oxidation-reduction process |
|
| RNA-seq Entry | A_BomoMG_comp39213_c0_seq2 |
Sequence (Amino Acid) | MLNLEILQYHQGPVSLCLHHHPVWGSDVEHFKPERWLDPTTLPENAFAGFSTGKRNCIGK
TFAMMSMKTTLAHLLRQYRVTADITRMEAKLDIILKPAFNHWISLEWRDK
*(36 a.a.) |