SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG12564_complete:A_BomoMG_comp39185_c0_seq2
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
Ontology
GO:0002230 P positive regulation of defense response to virus by host
GO:0003333 P amino acid transmembrane transport
GO:0005654 C nucleoplasm
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005779 C integral component of peroxisomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0005887 C integral component of plasma membrane
GO:0007031 P peroxisome organization
GO:0008289 F lipid binding
GO:0015171 F amino acid transmembrane transporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016557 P peroxisome membrane biogenesis
GO:0032994 C protein-lipid complex
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0045046 P protein import into peroxisome membrane
GO:0046983 F protein dimerization activity
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:0098792 P xenophagy
RNA-seq EntryA_BomoMG_comp39185_c0_seq2
Sequence
(Amino Acid)
MFWSIQTILCTDTVEGDPLKNMVYYLIGHNEINDSKLDTIVKETMDILESDEVISVTMSS
VSRSFSCVIDEVANLFVTKSIPPSKNQLEVEDHVITSGVLKLKSEPFVDVNKVEIYFVKL
LPVINDLITKNMCKGDNNIPDLLTQQLTLNEKLKLLGANIYEVFSNS
*(55 a.a.)

- SilkBase 1999-2023 -