SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG12449_5prime_partial:A_BomoMG_comp39136_c0_seq3
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
Ontology
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0000993 F RNA polymerase II complex binding
GO:0001162 F RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006334 P nucleosome assembly
GO:0006469 P negative regulation of protein kinase activity
GO:0008168 F methyltransferase activity
GO:0014904 P myotube cell development
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0032259 P methylation
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0034968 P histone lysine methylation
GO:0045184 P establishment of protein localization
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0071549 P cellular response to dexamethasone stimulus
RNA-seq EntryA_BomoMG_comp39136_c0_seq3
Sequence
(Amino Acid)
YVSSIVWLLQNTIRNCLNTFLSCSTIDVDVCNYCLDRHEGVLHPLNVMHAQTLDHAFEAH
VQMQLWEKACVYAERLIPCFRFYHGDKNPLLGLLYLKYGKILLYKMDLEKAVAQLKLAEK
IIKTTHGESHPLYREQLVPLLQQAMAEAD
*(49 a.a.)

- SilkBase 1999-2023 -