SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG12405_complete:A_BomoMG_comp39115_c0_seq3
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0002230 P positive regulation of defense response to virus by host
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006397 P mRNA processing
GO:0006915 P apoptotic process
GO:0008380 P RNA splicing
GO:0016607 C nuclear speck
GO:0030218 P erythrocyte differentiation
GO:0030263 P apoptotic chromosome condensation
GO:0035145 C exon-exon junction complex
GO:0042981 P regulation of apoptotic process
GO:0043065 P positive regulation of apoptotic process
GO:0044822 F RNA binding
GO:0045657 P positive regulation of monocyte differentiation
GO:0048025 P negative regulation of mRNA splicing, via spliceosome
GO:0061574 C ASAP complex
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:0098792 P xenophagy
RNA-seq EntryA_BomoMG_comp39115_c0_seq3
Sequence
(Amino Acid)
MREWDVGKNDKDKERDKLRREERPSEKRRHRTPERSPEPARKFKKKEEEAPAKLLDDLFR
KTKTTPCIYWLPLSAETIAIKEEQRRQHMAEYERRLLEQRRPPPHRRH
*(35 a.a.)

- SilkBase 1999-2023 -