SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG12242_5prime_partial:A_BomoMG_comp39056_c0_seq2
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0001553 P luteinization
GO:0001779 P natural killer cell differentiation
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004871 F obsolete signal transducer activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007165 P signal transduction
GO:0007259 P receptor signaling pathway via JAK-STAT
GO:0007565 P female pregnancy
GO:0007595 P lactation
GO:0008284 P positive regulation of cell population proliferation
GO:0019218 P regulation of steroid metabolic process
GO:0019221 P cytokine-mediated signaling pathway
GO:0019915 P lipid storage
GO:0030155 P regulation of cell adhesion
GO:0030856 P regulation of epithelial cell differentiation
GO:0038161 P prolactin signaling pathway
GO:0040018 P positive regulation of multicellular organism growth
GO:0042104 P positive regulation of activated T cell proliferation
GO:0042448 P progesterone metabolic process
GO:0043029 P T cell homeostasis
GO:0043066 P negative regulation of apoptotic process
GO:0045086 P positive regulation of interleukin-2 production
GO:0045579 P positive regulation of B cell differentiation
GO:0045647 P negative regulation of erythrocyte differentiation
GO:0045931 P positive regulation of mitotic cell cycle
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046543 P development of secondary female sexual characteristics
GO:0046544 P development of secondary male sexual characteristics
GO:0046983 F protein dimerization activity
GO:0050729 P positive regulation of inflammatory response
GO:0071363 P cellular response to growth factor stimulus
GO:0071364 P cellular response to epidermal growth factor stimulus
RNA-seq EntryA_BomoMG_comp39056_c0_seq2
Sequence
(Amino Acid)
VTTHHQVSNKKKCCSFVVCRNMQLRKIKRAEKKGTESVMDEKLTLLFQSQFNVGGGELVF
QVWTLSLPVVVIVHGNQEPHGWATVTWDNAFSPPGRVPFAVPDKVTWGQLAETLSLKFSS
ATGGSLSEDNLRFLAEKIFRTSLPLNTMELNAMAVSWTQFCKDALPERNFTFWEWFYMVV
KVTRDYLRTLWCDRLIMGFIQKKQAEDMLSKCPPGTFLLRFSDSELGGITIAWTGDGNEV
FSLQPFTSRDLMLRSLADRVFDLTQLQFLYPNVPKDDVFSKYYTKPENEMLKNGYVKPVL
VTTLPPYMSSSPAYAHSPDSHRNTPSVNSSYFGEATPIQVDSLMNSDLFEQIRAYEPDNQ
SDDFDIYSDMCLK
*(123 a.a.)

- SilkBase 1999-2023 -