SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG12178_complete:A_BomoMG_comp39027_c0_seq1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
Ontology
GO:0000209 P protein polyubiquitination
GO:0001701 P in utero embryonic development
GO:0003676 F nucleic acid binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006260 P DNA replication
GO:0006275 P regulation of DNA replication
GO:0006974 P cellular response to DNA damage stimulus
GO:0008270 F zinc ion binding
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0035264 P multicellular organism growth
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0044822 F RNA binding
GO:0046872 F metal ion binding
GO:0048568 P embryonic organ development
GO:0061053 P somite development
GO:0061630 F ubiquitin protein ligase activity
RNA-seq EntryA_BomoMG_comp39027_c0_seq1
Sequence
(Amino Acid)
MSVHYKFKSALDYDTVTFDGLHISVGDLKAAISQQKRIGKTSDFDLEITNAQTKEIYVDD
NALIPKNTSLLVARVPLSQQPKKQWEGSNSNSAPHKDVTVNKGLADLSRMEGSEQDKINA
MISQSTFDYDLAIIRK
*(44 a.a.)

- SilkBase 1999-2023 -