| Name | O_BomoMG119_internal:A_BomoMG_comp17246_c0_seq1 |
| Scaffold_id | Bomo_Chr26 |
NCBI non-redundant
(nr) | PREDICTED:_attractin-like_protein_1_[Bombyx_mori] |
| Ontology |
| GO:0004872 |
F |
signaling receptor activity |
| GO:0005576 |
C |
extracellular region |
| GO:0005615 |
C |
extracellular space |
| GO:0005737 |
C |
cytoplasm |
| GO:0005886 |
C |
plasma membrane |
| GO:0005887 |
C |
integral component of plasma membrane |
| GO:0006954 |
P |
inflammatory response |
| GO:0006979 |
P |
response to oxidative stress |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0021549 |
P |
cerebellum development |
| GO:0030246 |
F |
carbohydrate binding |
| GO:0040014 |
P |
regulation of multicellular organism growth |
| GO:0042552 |
P |
myelination |
| GO:0043473 |
P |
pigmentation |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomoMG_comp17246_c0_seq1 |
Sequence
(Amino Acid) | ENVWSAAPTQGWPARAGFGHSAAWDALSRRVYIHGGLVSESEATQAPSAALFEYDVESRV
FKPLPSAPTPRYLHSAVFVSPGVMLVFGGNAHNDSAAAAITNPTGARCYSAGA
(36 a.a.) |
