| Name | O_BomoMG11820_internal:A_BomoMG_comp38892_c0_seq1 |
| Scaffold_id | Bomo_Chr11 |
NCBI non-redundant
(nr) | nucleostemin_3_[Papilio_xuthus] |
| Ontology |
| GO:0000054 |
P |
ribosomal subunit export from nucleus |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003924 |
F |
GTPase activity |
| GO:0005525 |
F |
GTP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0005829 |
C |
cytosol |
| GO:0006810 |
P |
transport |
| GO:0007275 |
P |
multicellular organism development |
| GO:0008152 |
P |
metabolic process |
| GO:0009267 |
P |
cellular response to starvation |
| GO:0015030 |
C |
Cajal body |
| GO:0015031 |
P |
protein transport |
| GO:0016787 |
F |
hydrolase activity |
| GO:0040008 |
P |
regulation of growth |
| GO:0040018 |
P |
positive regulation of multicellular organism growth |
| GO:0046626 |
P |
regulation of insulin receptor signaling pathway |
| GO:0051168 |
P |
nuclear export |
|
| RNA-seq Entry | A_BomoMG_comp38892_c0_seq1 |
Sequence
(Amino Acid) | GQSNSSMPGHTRHIQSLILDNDIELLDCPGLVLPAYAVAPDLLLTAVLPIDQMRSHDAAM
ARLCQLVSKFTFEQKYGLLLPRTDDADELDYKQILTAHAYNRGFMTAAGQPDRSRSARLL
LKDAASGRLRWEQLPPGYQPAP
(46 a.a.) |
