SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG11808_internal:A_BomoMG_comp38883_c0_seq2
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
PREDICTED:_metastasis-associated_protein_MTA3_[Papilio_machaon]
Ontology
GO:0001046 F core promoter sequence-specific DNA binding
GO:0001047 F core promoter sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005791 C rough endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0006302 P double-strand break repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007565 P female pregnancy
GO:0008270 F zinc ion binding
GO:0010212 P response to ionizing radiation
GO:0016023 C cytoplasmic vesicle
GO:0019899 F enzyme binding
GO:0031410 C cytoplasmic vesicle
GO:0032496 P response to lipopolysaccharide
GO:0032922 P circadian regulation of gene expression
GO:0033363 P secretory granule organization
GO:0040029 P regulation of gene expression, epigenetic
GO:0043153 P entrainment of circadian clock by photoperiod
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043565 F sequence-specific DNA binding
GO:0045475 P locomotor rhythm
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0050727 P regulation of inflammatory response
GO:1902499 P positive regulation of protein autoubiquitination
GO:1903507 P negative regulation of nucleic acid-templated transcription
RNA-seq EntryA_BomoMG_comp38883_c0_seq2
Sequence
(Amino Acid)
DRQIDQFLVVSRSVGTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLHKSGYSIE
SALSSLVPASGPVLCRDEMEEWSASEANLFEEALDKYGKDFADIRQDFLPWKTLKNLVEY
YYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKPNPALITNNSSGSKSGVLNGGTNGT
PAPQLCASCQVTSSNQWYSWGPQHLQYRLCGTCWQYWKKYGGLKTAGVFSESEAETTKSV
REPDETALSAPHRPHRCAVLNCAKEFKLRAHLARHVATAHGGEGARPVMKTRAAFYLRAS
PYTRLARRLSRTLRRPKHYARSPFSPINLTLLKNDCTAGAEAGSASGGGSG
(116 a.a.)

- SilkBase 1999-2023 -