SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG11728_internal:A_BomoMG_comp38853_c1_seq1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)
GH22957_[Drosophila_grimshawi]
Ontology
GO:0003779 F actin binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0007050 P regulation of cell cycle
GO:0008017 F microtubule binding
GO:0008152 P metabolic process
GO:0010632 P regulation of epithelial cell migration
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016887 F ATP hydrolysis activity
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0032587 C ruffle membrane
GO:0032886 P regulation of microtubule-based process
GO:0042060 P wound healing
GO:0042995 C cell projection
GO:0043001 P Golgi to plasma membrane protein transport
GO:0046872 F metal ion binding
GO:0051893 P regulation of focal adhesion assembly
RNA-seq EntryA_BomoMG_comp38853_c1_seq1
Sequence
(Amino Acid)
KPLSILQLDPADRAVLRIADERDAIQKKTFTKWVNKHLKKVNRHVNDLFEDLRDGLNLIS
LLEVLSGEHLPRERGRMRFHMLQNVQMALDFLRYKKIKLVNIRAEDIV
(35 a.a.)

- SilkBase 1999-2023 -