SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG11667_5prime_partial:A_BomoMG_comp38823_c0_seq2
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
PREDICTED:_trithorax_group_protein_osa_[Bombyx_mori]
Ontology
GO:0003677 F DNA binding
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007379 P segment specification
GO:0007406 P negative regulation of neuroblast proliferation
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0014017 P neuroblast fate commitment
GO:0016055 P Wnt signaling pathway
GO:0016568 P chromatin organization
GO:0019233 P sensory perception of pain
GO:0022008 P neurogenesis
GO:0035060 C brahma complex
GO:0042058 P regulation of epidermal growth factor receptor signaling pathway
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046530 P photoreceptor cell differentiation
GO:0048190 P wing disc dorsal/ventral pattern formation
GO:0090544 C SWI/SNF superfamily-type complex
RNA-seq EntryA_BomoMG_comp38823_c0_seq2
Sequence
(Amino Acid)
PTAPLEHDNGPAPPATALVTTGPDGAPLDEGSQQSTLSNASAASGEECSSGKGRKEYSGS
AAPSPSPGGASHSSLHDDYDASPSSWPRPPSSPVFNSHIPPETYRSKVYIKLKIISMLL
*(39 a.a.)

- SilkBase 1999-2023 -