SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG115_internal:A_BomoMG_comp17215_c0_seq1
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
PREDICTED:_probable_DNA_mismatch_repair_protein_Msh6_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0000400 F four-way junction DNA binding
GO:0000710 P meiotic mismatch repair
GO:0000790 C chromatin
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003684 F damaged DNA binding
GO:0003690 F double-stranded DNA binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0006281 P DNA repair
GO:0006298 P mismatch repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007131 P reciprocal meiotic recombination
GO:0008340 P determination of adult lifespan
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009411 P response to UV
GO:0016446 P somatic hypermutation of immunoglobulin genes
GO:0016447 P somatic recombination of immunoglobulin gene segments
GO:0016887 F ATP hydrolysis activity
GO:0030983 F mismatched DNA binding
GO:0032137 F guanine/thymine mispair binding
GO:0032138 F single base insertion or deletion binding
GO:0032142 F single guanine insertion binding
GO:0032143 F single thymine insertion binding
GO:0032301 C MutSalpha complex
GO:0032357 F oxidized purine DNA binding
GO:0032405 F MutLalpha complex binding
GO:0035064 F methylated histone binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0043531 F ADP binding
GO:0043570 P maintenance of DNA repeat elements
GO:0045190 P isotype switching
GO:0045830 P positive regulation of isotype switching
GO:0045910 P negative regulation of DNA recombination
GO:0051096 P positive regulation of helicase activity
GO:0097193 P intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoMG_comp17215_c0_seq1
Sequence
(Amino Acid)
EAKSEKKKESIVEKKLQDSFKYEPNQTSKSNKNTKTTAGSKSKTILPEENPKSQEEESSD
GNWVHCKLDWLKPDKIRDAMKRKLDHPDYNPRTLYVPPDFLKSQTPAHQQWWIMKSTNFD
CVLFFKVGKFYELYHM
(44 a.a.)

- SilkBase 1999-2023 -