SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG11230_internal:A_BomoMG_comp38622_c2_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		PREDICTED:_protein_scalloped_isoform_X1_[Amyelois_transitella]
Ontology
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001745 P compound eye morphogenesis
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0007275 P multicellular organism development
GO:0007293 P germarium-derived egg chamber formation
GO:0007399 P nervous system development
GO:0007423 P sensory organ development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007525 P somatic muscle development
GO:0008134 F transcription factor binding
GO:0019904 F protein domain specific binding
GO:0030154 P cell differentiation
GO:0035220 P wing disc development
GO:0035331 P negative regulation of hippo signaling
GO:0044212 F transcription cis-regulatory region binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0055013 P cardiac muscle cell development
GO:0060429 P epithelium development
GO:0072089 P stem cell proliferation
GO:2000826 P regulation of heart morphogenesis
RNA-seq EntryA_BomoMG_comp38622_c2_seq1
Sequence
(Amino Acid)
DTNGSGGADAKHLDVGDASDDEKDMSAADAEGVWSPDIEQSFQEALAIYPPCGRRKIILS
DEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKLREIQAKLKVQFWQP
(37 a.a.)

- SilkBase 1999-2023 -