SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG11163_internal:A_BomoMG_comp38589_c1_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		PREDICTED:_ubiquilin-1-like_[Amyelois_transitella]
Ontology
GO:0000502 C proteasome complex
GO:0005102 F signaling receptor binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005776 C autophagosome
GO:0005783 C endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0006914 P autophagy
GO:0016020 C membrane
GO:0016235 C aggresome
GO:0016241 P regulation of macroautophagy
GO:0019215 F intermediate filament binding
GO:0019900 F kinase binding
GO:0030433 P ubiquitin-dependent ERAD pathway
GO:0031396 P regulation of protein ubiquitination
GO:0031398 P positive regulation of protein ubiquitination
GO:0031410 C cytoplasmic vesicle
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0034140 P negative regulation of toll-like receptor 3 signaling pathway
GO:0034976 P response to endoplasmic reticulum stress
GO:0035973 P aggrephagy
GO:0042802 F identical protein binding
GO:0043234 C protein-containing complex
GO:0048471 C perinuclear region of cytoplasm
GO:0071456 P cellular response to hypoxia
GO:1901097 P negative regulation of autophagosome maturation
GO:1901340 P negative regulation of store-operated calcium channel activity
GO:1902175 P regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:1903071 P positive regulation of ER-associated ubiquitin-dependent protein catabolic process
GO:2000785 P regulation of autophagosome assembly
RNA-seq EntryA_BomoMG_comp38589_c1_seq1
Sequence
(Amino Acid)
YKSTLFVNLSFSYKFYFSAKVHSHSRIAKMAEGQDDPKKITITVKTPKEKQQVEIEEDAD
IKRLKEVLSSKFSTEPEQLCLIFAGKIMNDADTLKQHNIKDGLTVHLVIKAPPRPEPEGA
ARRPPADVSATPFGLNSLGGLAGLESLGLGQSTFMDLQARMQQELLSNPDMLRQVLDNPL
VQQMMNDPENMRSLITSNPQMQDLMSRNPEISHMLNNPELLRQTMELARNPAMLQELMRS
HDRALSNLESIPGGYNALQRMYRDIQEPMLNVASSMAGNPFSGLVDNSDGTNPQQGSENR
QPLPNPWQRGGGGGGG
(104 a.a.)

- SilkBase 1999-2023 -