SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG110_internal:A_BomoMG_comp17209_c0_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		PREDICTED:_transformation/transcription_domain-associated_protein_[Bombyx_mori]
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0000124 C SAGA complex
GO:0000281 P mitotic cytokinesis
GO:0004402 F histone acetyltransferase activity
GO:0004672 F protein kinase activity
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0005703 C polytene chromosome puff
GO:0005737 C cytoplasm
GO:0005875 C microtubule associated complex
GO:0006281 P DNA repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006909 P phagocytosis
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016568 P chromatin organization
GO:0016573 P histone acetylation
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0035222 P wing disc pattern formation
GO:0035267 C NuA4 histone acetyltransferase complex
GO:0043486 P histone exchange
GO:0043966 P histone H3 acetylation
GO:0045747 P positive regulation of Notch signaling pathway
RNA-seq EntryA_BomoMG_comp17209_c0_seq1
Sequence
(Amino Acid)
QSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSHTLISQGLRTLELCV
DNLQPDFLYEHIQPVRADLMQALWRTLHNNEVARIAFRVLGKFGGGNRKMMIEPQRLEYR
ETDVPPPSVQAYFQDQAKPIDFEVDKVIETAFCALKSSTTDPFYRKQCW
(55 a.a.)

- SilkBase 1999-2023 -