SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG1108_5prime_partial:A_BomoMG_comp19870_c0_seq1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		PREDICTED:_transcriptional_activator_protein_Pur-alpha_isoform_X2_[Bombyx_mori]
Ontology
GO:0000784 C chromosome, telomeric region
GO:0000900 F translation repressor activity, mRNA regulatory element binding
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003691 F double-stranded telomeric DNA binding
GO:0003697 F single-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005662 C DNA replication factor A complex
GO:0005737 C cytoplasm
GO:0006268 P DNA unwinding involved in DNA replication
GO:0006270 P DNA replication initiation
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007399 P nervous system development
GO:0008134 F transcription factor binding
GO:0008284 P positive regulation of cell population proliferation
GO:0017148 P negative regulation of translation
GO:0030154 P cell differentiation
GO:0030425 C dendrite
GO:0032422 F purine-rich negative regulatory element binding
GO:0042127 P regulation of cell population proliferation
GO:0043025 C neuronal cell body
GO:0044822 F RNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046332 F SMAD binding
RNA-seq EntryA_BomoMG_comp19870_c0_seq1
Sequence
(Amino Acid)
RIRTVLEFSKPKRSVNSLKNSVCIAMSDIGSGDEGINSQKYHGQGMDAGGNNFDSGQQPQ
EQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIFLAMSTAAEFRDHLSSF
SDFYSSLGPPNPDNVPDDGKLKSEMMLKDNRRYYLDLKENSRGRFLRVSQTITRGGPRSQ
IALPAQGMIEFRDALTDLLDDFGTDDGGFKGELPEGRHLRVDNKNFYFDIGQNNRGIYMK
VSESNFRTAITVPEKCWTRFRDILADYCDKMCRAHQQNAENHQSGPIPGGSGVRGGPSQP
APSSSDIDTFSCNVPNRI
*(105 a.a.)

- SilkBase 1999-2023 -