| Name | O_BomoMG11064_internal:A_BomoMG_comp38547_c0_seq4 |
| Scaffold_id | Bomo_Chr8 |
NCBI non-redundant
(nr) | PREDICTED:_septin-5_isoform_X3_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000910 |
P |
cytokinesis |
| GO:0003924 |
F |
GTPase activity |
| GO:0005198 |
F |
structural molecule activity |
| GO:0005515 |
F |
protein binding |
| GO:0005525 |
F |
GTP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005886 |
C |
plasma membrane |
| GO:0005938 |
C |
cell cortex |
| GO:0007049 |
P |
cell cycle |
| GO:0008021 |
C |
synaptic vesicle |
| GO:0016080 |
P |
synaptic vesicle targeting |
| GO:0017157 |
P |
regulation of exocytosis |
| GO:0019905 |
F |
syntaxin binding |
| GO:0043195 |
C |
terminal bouton |
| GO:0043679 |
C |
axon terminus |
| GO:0045202 |
C |
synapse |
| GO:0045921 |
P |
positive regulation of exocytosis |
| GO:0051301 |
P |
cell division |
| GO:2000300 |
P |
regulation of synaptic vesicle exocytosis |
|
| RNA-seq Entry | A_BomoMG_comp38547_c0_seq4 |
Sequence
(Amino Acid) | DSWRVCSAYIDEQFRQYFTDESGLNRRHMQDNRVHCCLYFVPPWAHSLRQVDLEMMKRLH
RKVNIVVVIAKADSLTAIEIKRLKARILNDLEEHQIQVYQFPECDSATLSTTINA
(37 a.a.) |
