SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG11063_internal:A_BomoMG_comp38547_c0_seq3
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
PREDICTED:_septin-2_[Amyelois_transitella]
Ontology
GO:0000145 C exocyst
GO:0000166 F nucleotide binding
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0002036 P regulation of L-glutamate import across plasma membrane
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005930 C axoneme
GO:0005938 C cell cortex
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007224 P smoothened signaling pathway
GO:0009986 C cell surface
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0030234 F enzyme regulator activity
GO:0030496 C midbody
GO:0031105 C septin complex
GO:0031175 P neuron projection development
GO:0031513 C non-motile cilium
GO:0032154 C cleavage furrow
GO:0032391 C photoreceptor connecting cilium
GO:0032880 P regulation of protein localization
GO:0032947 F molecular adaptor activity
GO:0035869 C ciliary transition zone
GO:0042384 P cilium assembly
GO:0042995 C cell projection
GO:0043209 C myelin sheath
GO:0045202 C synapse
GO:0048471 C perinuclear region of cytoplasm
GO:0050790 P regulation of catalytic activity
GO:0051301 P cell division
GO:0060170 C ciliary membrane
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoMG_comp38547_c0_seq3
Sequence
(Amino Acid)
LRLFPPGGAPVQAKSPITTVIKIQRDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVVGE
SGLGKSTLINSLFLGDLYKNRKIPDVQDRIEKTTTIEKKTMEIEERGVKLRLTIVDTPGF
GDAINCEDSWRVCSA
(44 a.a.)

- SilkBase 1999-2023 -