| Name | O_BomoMG11062_3prime_partial:A_BomoMG_comp38547_c0_seq2 |
| Scaffold_id | Bomo_Chr8 |
NCBI non-redundant (nr) | PREDICTED:_septin-2_[Amyelois_transitella] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0002036 |
P |
regulation of L-glutamate import across plasma membrane |
| GO:0005525 |
F |
GTP binding |
| GO:0005634 |
C |
nucleus |
| GO:0005730 |
C |
nucleolus |
| GO:0005737 |
C |
cytoplasm |
| GO:0005819 |
C |
spindle |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005886 |
C |
plasma membrane |
| GO:0005938 |
C |
cell cortex |
| GO:0007049 |
P |
cell cycle |
| GO:0007067 |
P |
mitotic cell cycle |
| GO:0007224 |
P |
smoothened signaling pathway |
| GO:0009986 |
C |
cell surface |
| GO:0015629 |
C |
actin cytoskeleton |
| GO:0016020 |
C |
membrane |
| GO:0030234 |
F |
enzyme regulator activity |
| GO:0030496 |
C |
midbody |
| GO:0032154 |
C |
cleavage furrow |
| GO:0032880 |
P |
regulation of protein localization |
| GO:0032947 |
F |
molecular adaptor activity |
| GO:0035869 |
C |
ciliary transition zone |
| GO:0042384 |
P |
cilium assembly |
| GO:0042995 |
C |
cell projection |
| GO:0043209 |
C |
myelin sheath |
| GO:0045202 |
C |
synapse |
| GO:0050790 |
P |
regulation of catalytic activity |
| GO:0051301 |
P |
cell division |
| GO:0060170 |
C |
ciliary membrane |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomoMG_comp38547_c0_seq2 |
Sequence (Amino Acid) | MENSDSFAILDINLSDKDKDELKKNDGNKKSPITTVIKIQRDRGERDYIGFATLPEQVHR
KSVKRGFDFTLMVVGESGLGKSTLINSLFLGDLYKNRKIPDVQDRIEKTTTIEKKTMEIE
ERGVKLRLTIVDTPGFGDAINCEDSWRVCSA
(49 a.a.) |