SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG11041_5prime_partial:A_BomoMG_comp38538_c0_seq1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
Mitogen-activated_protein_kinase_kinase_kinase_7_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0000186 P obsolete activation of MAPKK activity
GO:0000187 P obsolete activation of MAPK activity
GO:0000287 F magnesium ion binding
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0002726 P positive regulation of T cell cytokine production
GO:0002755 P MyD88-dependent toll-like receptor signaling pathway
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004709 F MAP kinase kinase kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005671 C obsolete Ada2/Gcn5/Ada3 transcription activator complex
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007165 P signal transduction
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007223 P Wnt signaling pathway, calcium modulating pathway
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0007250 P activation of NF-kappaB-inducing kinase activity
GO:0007252 P I-kappaB phosphorylation
GO:0007254 P JNK cascade
GO:0008385 C IkappaB kinase complex
GO:0010008 C endosome membrane
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0032743 P positive regulation of interleukin-2 production
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043507 P positive regulation of JUN kinase activity
GO:0043966 P histone H3 acetylation
GO:0046872 F metal ion binding
GO:0050852 P T cell receptor signaling pathway
GO:0050870 P positive regulation of T cell activation
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051403 P stress-activated MAPK cascade
GO:0070423 P nucleotide-binding oligomerization domain containing signaling pathway
GO:0097110 F scaffold protein binding
RNA-seq EntryA_BomoMG_comp38538_c0_seq1
Sequence
(Amino Acid)
PPARFRRIDACDATTGIVTTIRDAVSCSWIFYSNSSSSTGGEGGAPASEPDPALDSMHMM
LDPHLRPISPDLSNEESKRIFEKHKQLAQEYLKIQTELAYLSNHKTELEEKMDDDELRQK
REMIQLENEKESLIKLYCSLNKQLARAENDSWLHSEEMPHE
*(53 a.a.)

- SilkBase 1999-2023 -