SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG11003_3prime_partial:A_BomoMG_comp38527_c0_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		PREDICTED:_unconventional_myosin-IXa-like_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003774 F cytoskeletal motor activity
GO:0003779 F actin binding
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005829 C cytosol
GO:0007165 P signal transduction
GO:0007601 P visual perception
GO:0008152 P metabolic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016459 C myosin complex
GO:0016461 C unconventional myosin complex
GO:0035556 P intracellular signal transduction
GO:0043547 P positive regulation of GTPase activity
GO:0046872 F metal ion binding
GO:0051056 P regulation of small GTPase mediated signal transduction
RNA-seq EntryA_BomoMG_comp38527_c0_seq1
Sequence
(Amino Acid)
MLETVRIRQAGYNVRLTYEEFIQLYRILLPKGLLSSQTDVRHFLATLNLDRDNYQLGMTK
IFMRESEQTKLEYRLHQQIMASIITIQRWFRAVLERRRFVVLRRASHVIQYYCRQW
(37 a.a.)

- SilkBase 1999-2023 -