| Name | O_BomoMG10824_complete:A_BomoMG_comp38449_c0_seq1 |
| Scaffold_id | Bomo_Chr8 |
NCBI non-redundant
(nr) | PREDICTED:_AP-2_complex_subunit_mu_[Dufourea_novaeangliae] |
| Ontology |
| GO:0005048 |
F |
signal sequence binding |
| GO:0005739 |
C |
mitochondrion |
| GO:0005886 |
C |
plasma membrane |
| GO:0005905 |
C |
clathrin-coated pit |
| GO:0006810 |
P |
transport |
| GO:0006886 |
P |
intracellular protein transport |
| GO:0006897 |
P |
endocytosis |
| GO:0008289 |
F |
lipid binding |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0016192 |
P |
vesicle-mediated transport |
| GO:0030131 |
C |
clathrin adaptor complex |
| GO:0044325 |
F |
transmembrane transporter binding |
| GO:0070062 |
C |
extracellular exosome |
| GO:1903077 |
P |
negative regulation of protein localization to plasma membrane |
|
| RNA-seq Entry | A_BomoMG_comp38449_c0_seq1 |
Sequence
(Amino Acid) | MIGGLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKR
ANIWLAAVTKQNVNAAMVFEFLLKIIDVMQSYFGKISEENIKNNFVLI
*(35 a.a.) |
