SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG10643_5prime_partial:A_BomoMG_comp38323_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
PREDICTED:_85/88_kDa_calcium-independent_phospholipase_A2_[Papilio_machaon]
Ontology
GO:0001934 P positive regulation of protein phosphorylation
GO:0004623 F phospholipase A2 activity
GO:0005516 F calmodulin binding
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0006629 P lipid metabolic process
GO:0006935 P chemotaxis
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007613 P memory
GO:0008152 P metabolic process
GO:0014832 P urinary bladder smooth muscle contraction
GO:0016020 C membrane
GO:0016042 P lipid catabolic process
GO:0016787 F hydrolase activity
GO:0019731 P antibacterial humoral response
GO:0019901 F protein kinase binding
GO:0032049 P cardiolipin biosynthetic process
GO:0034976 P response to endoplasmic reticulum stress
GO:0035774 P positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0043008 F ATP-dependent protein binding
GO:0045909 P vasodilation
GO:0045921 P positive regulation of exocytosis
GO:0047499 F calcium-independent phospholipase A2 activity
GO:0051967 P negative regulation of synaptic transmission, glutamatergic
GO:0060135 P maternal process involved in female pregnancy
GO:0090037 P positive regulation of protein kinase C signaling
GO:0090200 P positive regulation of release of cytochrome c from mitochondria
GO:0090238 P positive regulation of arachidonic acid secretion
GO:1901339 P regulation of store-operated calcium channel activity
GO:2000304 P positive regulation of ceramide biosynthetic process
RNA-seq EntryA_BomoMG_comp38323_c0_seq1
Sequence
(Amino Acid)
RPAPPPPPPHQQLVWQVARATGAAPSYFRASGRYLDGGLMGNNPTLDALTELAELGLALR
GTGRGELAAACGLKIVVSCGTGQIPVTPVKDFDVFKPESLWDTARLAWGLSALGSLLVDQ
ATQADGRVVERARAWCGAAGVPYYRFSPPMSRDVSMDERSDERLVCMLWEAQAYMRDHRD
EVAELAALLADAGENDK
*(65 a.a.)

- SilkBase 1999-2023 -