SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10636_3prime_partial:A_BomoMG_comp38316_c0_seq3
Scaffold_idBomo_Scaf007
NCBI non-redundant
(nr)		putative_mitogen-activated_protein_kinase_(MAPKK)_[Heliconius_melpomene]
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000187 P obsolete activation of MAPK activity
GO:0001934 P positive regulation of protein phosphorylation
GO:0002931 P response to ischemia
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004708 F MAP kinase kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019901 F protein kinase binding
GO:0022602 P ovulation cycle process
GO:0032308 P positive regulation of prostaglandin secretion
GO:0042493 P response to xenobiotic stimulus
GO:0043065 P positive regulation of apoptotic process
GO:0051149 P positive regulation of muscle cell differentiation
GO:0051770 P positive regulation of nitric-oxide synthase biosynthetic process
GO:0060048 P cardiac muscle contraction
GO:0072709 P cellular response to sorbitol
RNA-seq EntryA_BomoMG_comp38316_c0_seq3
Sequence
(Amino Acid)
MSRRKLPPPGFNFKTQTEQVVTPPGNLDKQTTITVDDRTFTVHADDLVKICDLGRGAYGI
VEKMRHLPSNTIMAVKRITATFNNQSLEQKRLLMDLDVSMRASACPYTVHFYGAMFREG
(38 a.a.)

- SilkBase 1999-2023 -