SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10612_internal:A_BomoMG_comp38303_c1_seq1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		PREDICTED:_zinc_finger_protein_62_homolog_isoform_X2_[Papilio_xuthus]
Ontology
GO:0001752 P compound eye photoreceptor fate commitment
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007601 P visual perception
GO:0007605 P sensory perception of sound
GO:0009649 P entrainment of circadian clock
GO:0010114 P response to red light
GO:0035271 P ring gland development
GO:0042051 P compound eye photoreceptor development
GO:0043153 P entrainment of circadian clock by photoperiod
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0050896 P response to stimulus
GO:0060086 P circadian temperature homeostasis
RNA-seq EntryA_BomoMG_comp38303_c1_seq1
Sequence
(Amino Acid)
PHCPEVFVSYYDRSEHLVKVHNQTPILYPCNACNKIYKKKFELNRHIKHHHLQQKNFVCD
KCNAMFFSKRGLVDHIARHEGAEMFSCDICGKSFSRLRTLKEHLRMHENDTRYQCKVCKR
TFMQKGGLKNHVRLHQDNLDIFKEFDDVKHLIDNRELTLKQIAAENKKKELAQKQQG
(58 a.a.)

- SilkBase 1999-2023 -