SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10478_3prime_partial:A_BomoMG_comp38218_c0_seq1
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		PREDICTED:_serine/threonine-protein_kinase_pelle-like_[Papilio_machaon]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0006606 P protein import into nucleus
GO:0006915 P apoptotic process
GO:0006952 P defense response
GO:0007165 P signal transduction
GO:0007352 P zygotic specification of dorsal/ventral axis
GO:0008063 P Toll signaling pathway
GO:0009620 P response to fungus
GO:0009950 P dorsal/ventral axis specification
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019732 P antifungal humoral response
GO:0019904 F protein domain specific binding
GO:0030097 P hemopoiesis
GO:0030162 P regulation of proteolysis
GO:0035172 P hemocyte proliferation
GO:0035556 P intracellular signal transduction
GO:0045087 P innate immune response
GO:0046777 P protein autophosphorylation
GO:0048262 P determination of dorsal/ventral asymmetry
RNA-seq EntryA_BomoMG_comp38218_c0_seq1
Sequence
(Amino Acid)
MTGSALIHGDIKPANILLDQCLEPKIGDFGLARKGPYGDERTHLKVSRVYGTRPYLPDEY
LQSCVLSPAVDVYSFGVVVAETSTGLPAWDRSRARPLLAHQLRS
(33 a.a.)

- SilkBase 1999-2023 -