SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10468_internal:A_BomoMG_comp38213_c1_seq1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)		PREDICTED:_LOW_QUALITY_PROTEIN:_protein_split_ends_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000398 P mRNA splicing, via spliceosome
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007379 P segment specification
GO:0007400 P neuroblast fate determination
GO:0007403 P glial cell fate determination
GO:0007411 P axon guidance
GO:0007422 P peripheral nervous system development
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0016055 P Wnt signaling pathway
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0035222 P wing disc pattern formation
GO:0035321 P maintenance of imaginal disc-derived wing hair orientation
GO:0048106 P establishment of thoracic bristle planar orientation
GO:0048749 P compound eye development
GO:0050832 P defense response to fungus
RNA-seq EntryA_BomoMG_comp38213_c1_seq1
Sequence
(Amino Acid)
KHFGRIIEIDIKKGSGGGAGYAFCQYASISSVVEAIRAMDGEYVGGSRVKLGFGKPVATT
CVWVDGLTEHTEKQVLGAVSRCGAATSVCVDRAAGAALVHF
(32 a.a.)

- SilkBase 1999-2023 -