SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10442_complete:A_BomoMG_comp38201_c0_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		PREDICTED:_translation_initiation_factor_eIF-2B_subunit_epsilon_isoform_X2_[Bombyx_mori]
Ontology
GO:0001541 P ovarian follicle development
GO:0003743 F translation initiation factor activity
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005851 C eukaryotic translation initiation factor 2B complex
GO:0006412 P translation
GO:0006413 P translational initiation
GO:0007568 P aging
GO:0009408 P response to heat
GO:0009749 P response to glucose
GO:0010226 P response to lithium ion
GO:0014002 P astrocyte development
GO:0014003 P oligodendrocyte development
GO:0021766 P hippocampus development
GO:0031369 F translation initiation factor binding
GO:0034976 P response to endoplasmic reticulum stress
GO:0035690 P cellular response to xenobiotic stimulus
GO:0042552 P myelination
GO:0043065 P positive regulation of apoptotic process
GO:0043434 P response to peptide hormone
GO:0043547 P positive regulation of GTPase activity
GO:0045727 P positive regulation of translation
GO:0045948 P positive regulation of translational initiation
GO:0048708 P astrocyte differentiation
RNA-seq EntryA_BomoMG_comp38201_c0_seq1
Sequence
(Amino Acid)
MPVLSEAKNVLTTVKDILKYFRPVLANYIKSKSSIMDCLRAVEDTCLNCEWLDGKSGQIL
HLLYEADVVDEDSLVDWYAELKENANPFVKQPSLVKFFEWLQEASEESDDSE
*(36 a.a.)

- SilkBase 1999-2023 -