SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10399_internal:A_BomoMG_comp38162_c1_seq1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		PREDICTED:_sprouty-related,_EVH1_domain-containing_protein_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000188 P obsolete inactivation of MAPK activity
GO:0005173 F stem cell factor receptor binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0007275 P multicellular organism development
GO:0009966 P regulation of signal transduction
GO:0010801 P negative regulation of peptidyl-threonine phosphorylation
GO:0016020 C membrane
GO:0019901 F protein kinase binding
GO:0030291 F protein serine/threonine kinase inhibitor activity
GO:0030658 C transport vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0043517 P positive regulation of DNA damage response, signal transduction by p53 class mediator
GO:0090311 P regulation of protein deacetylation
RNA-seq EntryA_BomoMG_comp38162_c1_seq1
Sequence
(Amino Acid)
GGYLESANRAGSCEYAPDCCRTFVDKVSCIACAQCFVYHCISEPEGENASRPCACAQPHR
ECVLRWLGITLLSVLIPCLWCCVPLKCFHRAARAAHVAGGQHAPAHTHAHANI
(36 a.a.)

- SilkBase 1999-2023 -